Home » Budaya » Kesadaran Kultural Indonesia yang Terkoyak

Kesadaran Kultural Indonesia yang Terkoyak

Entah, produk budaya Indonesia apa lagi yang hendak dicaplok negeri Jiran. Yang pasti, hingga saat ini, sudah ada puluhan produk budaya kita yang nyata-nyata telah diklaim dan dipatenkan oleh sebuah negara kecil yang konon tak pernah merasakan etos perjuangan dan buta kebudayaan itu. Bagaimana tidak? Malaysia tak se-heroik Indonesia dalam berjuang merebut dan mempertahankan eksistensi negara-bangsa. Untuk mempertahankan dan merebut eksistensi negara yang merdeka dan berdaulat penuh, Indonesia mesti berdarah-darah dan mengorbankan segalanya. Lain halnya dengan Malaysia. Mereka bisa hidup makmur karena proteksi dan belas kasihan negara lain yang dulu menjajahnya. Semua kemanjaan mereka dapatkan secara instan. Tak heran apabila Malaysia ktak pernah bisa menghargai karya cipta dan kreativitas bangsa serumpun. Mereka juga tak pernah mengenal dan mengasah kepekaan kultural. Karena tak pernah mengenal dinamika berkesenian dan berkebudayaan, merka hanya bisa menjiplak, main klaim, mencuri, dan main caplok.

Ironisnya, pemerintah kita seperti tutup mata dan tutup telinga terhadap ulah negeri jiran itu. Apa tidak pernah terusik untuk berpikir, bagaimana nasib para perajin dan pekerja seni di negeri ini jika mereka harus menyerahkan sejumlah royalty ke negeri jiran karena secara hukum, kita sudah tak memiliki hak atas produk-produk budaya yang telah dipatenkan Malaysia itu.

Ulah Malaysia juga perlu dijadikan sebagai “warning” buat bangsa kita agar tak terlalu silau dengan budaya global yang selama ini (nyaris) telah menggerus jati diri bangsa. Kita yang selama ini abai terhadap budaya kita sendiri, baru teriak kencang-kencang setelah diklaim negeri lain. Dalam kondisi demikian, kita perlu membangun kembali kesadaran kultural secara kolektif setelah kita terninabobokan dan terhipnotis oleh kultur global yang secara langsung maupun tidak langsung telah membuat kita terlena dan abai terhadap budaya negeri sendiri.

Dari search engine, ada beberapa produk budaya Indonesia yang diduga telah dicaplok oleh Malasyia. Berikut ini daftarnya.
1.Batik
2.Tari Pendet
3.Wayang Kulit
4.Angklung
5.Reog Ponorogo
6.Kuda Lumping
7.Lagu Rasa Sayange
8.Bunga Rafflesia Arnoldi
9.Keris
10.Rendang Padang

wayang kulitangklungreog-ponorogokuda_lumpingvisitmalingsiarafflesiakerisrendang-padang

Sementara itu, menurut versi budaya-indonesia.org, sudah lebih banyak lagi daftar artefak budaya Indonesia yang diduga dicuri, dipatenkan, diklaim, dan atau dieksploitasi secara komersial oleh korporasi asing, oknum warga negara asing, ataupun negara lain. Berikut ini daftarnya:

  1. Batik dari Jawa oleh Adidas
  2. Naskah Kuno dari Riau oleh Pemerintah Malaysia
  3. Naskah Kuno dari Sumatera Barat oleh Pemerintah Malaysia
  4. Naskah Kuno dari Sulawesi Selatan oleh Pemerintah Malaysia
  5. Naskah Kuno dari Sulawesi Tenggara oleh Pemerintah Malaysia
  6. Rendang dari Sumatera Barat oleh Oknum WN Malaysia
  7. Sambal Bajak dari Jawa Tengah oleh Oknum WN Belanda
  8. Sambal Petai dari Riau oleh Oknum WN Belanda
  9. Sambal Nanas dari Riau oleh Oknum WN Belanda
  10. Tempe dari Jawa oleh Beberapa Perusahaan Asing
  11. Lagu Rasa Sayang Sayange dari Maluku oleh Pemerintah Malaysia
  12. Tari Reog Ponorogo dari Jawa Timur oleh Pemerintah Malaysia
  13. Lagu Soleram dari Riau oleh Pemerintah Malaysia
  14. Lagu Injit-injit Semut dari Jambi oleh Pemerintah Malaysia
  15. Alat Musik Gamelan dari Jawa oleh Pemerintah Malaysia
  16. Tari Kuda Lumping dari Jawa Timur oleh Pemerintah Malaysia
  17. Tari Piring dari Sumatera Barat oleh Pemerintah Malaysia
  18. Lagu Kakak Tua dari Maluku oleh Pemerintah Malaysia
  19. Lagu Anak Kambing Saya dari Nusa Tenggara oleh Pemerintah Malaysia
  20. Kursi Taman Dengan Ornamen Ukir Khas Jepara dari Jawa Tengah oleh Oknum WN Perancis
  21. Pigura Dengan Ornamen Ukir Khas Jepara dari Jawa Tengah oleh Oknum WN Inggris
  22. Motif Batik Parang dari Yogyakarta oleh Pemerintah Malaysia
  23. Desain Kerajinan Perak Desak Suwarti dari Bali oleh Oknum WN Amerika
  24. Produk Berbahan Rempah-rempah dan Tanaman Obat Asli Indonesia oleh Shiseido Co Ltd
  25. Badik Tumbuk Lada oleh Pemerintah Malaysia
  26. Kopi Gayo dari Aceh oleh perusahaan multinasional (MNC) Belanda
  27. Kopi Toraja dari Sulawesi Selatan oleh perusahaan Jepang
  28. Musik Indang Sungai Garinggiang dari Sumatera Barat oleh Malaysia
  29. Kain Ulos oleh Malaysia
  30. Alat Musik Angklung oleh Pemerintah Malaysia
  31. Lagu Jali-Jali oleh Pemerintah Malaysia
  32. Tari Pendet dari Bali oleh Pemerintah Malaysia

Sudah saatnya kita kembali meneguhkan sikap untuk peduli dan membangun kesadaran kultural secara kolektif untuk merebut kembali produk budaya yang telah dicaplok orang itu. Sebagai bangsa yang besar, kita jangan gampang menyerah dan bersikap permisif. Ayo, rebut kembali produk-produk budaya bangsa kita yang hilang itu. Kalau tidak sekarang, kapan lagi? ***

tentang blog iniTulisan berjudul "Kesadaran Kultural Indonesia yang Terkoyak" dipublikasikan oleh Sawali Tuhusetya (21 Februari 2010 @ 07:24) pada kategori Budaya. Anda bisa mengikuti respon terhadap tulisan ini melalui feed komentar RSS 2.0, memberikan respon, atau melakukan trackback dari blog Anda. Terima kasih atas kunjungan, silaturahmi, saran, dan kritik Anda selama ini. Salam budaya!

Tulisan Terkait:

Tinggalkan Balasan

Alamat surel Anda tidak akan dipublikasikan. Ruas yang wajib ditandai *